Navigation

Share This Page:

FunnyPart.com:

Game Cheats @ MoFunZone.com

Turok 2: Seeds Of Evil Cheats For Gameboy

Strategy Guide

  • Level select

    Enter "DLVTRKBLVL" as a password.

  • Infinite lives

    Enter "DLVTRKBLVS" as a password.

  • Infinite health

    Enter "DLVTRKBNRG" as a password.

  • All weapons

    Enter "DLVTRKBWPS" as a password.

  • Bird mode

    Enter "DLVTRKBBRD" as a password. Then while playing game, hold Select and press A to fly.

  • Powerful weapons

    Enter "QVZLBVSQLV" as a password and play the game on the medium difficulty setting. Intentionally lose all lives, then re-enter the same password. Begin a new game on the easy difficulty setting, then intentionally lose all lives. Begin another new game on the easy difficulty setting, then collect the light burden. Your character will now possess the particle accelerator and the chain gun. Note: Collect the pistol on level 2 to get ammunition for the chain gun.

  • Alternate end sequence

    When the enemy appears in level 9, press Down. After entering the tunnel, shoot the computer and destroy the incubator. Then an alternate ending sequence will begin.

  • Level passwords

    Level
    		EasyMediumHard
    2
    		DVYLWKVYNLQVYLWKVYDTDLTLWKVYYC
    3
    		GRYLWKWVNRTRYLWKWVNNGNYLWKWVPP
    4
    		DRYLSRWVRYQRYLSRWVTSDNYLSRWVPT
    5
    		GVZLSRWQKZTVZLSRSQKBGLZLSRSVPW
    6
    		DVZLSVQKKQVZLBVSQRLDLZLBVSVVB
    7
    		GRZLBVSQZYTRZLBVBQKBGNZLBVBQVL
    8
    		DRZLBVSQGGQRZLBVBQKSDNZLBVBQVN
    9
    		GVYNBVBQGDTVYNBVBQRLGLYNBVBQQD

    Game Shark Codes

    Note: You must have a 2.1 or higher version of the Game Shark to use these codes in a Game Boy Color system.

    Infinite Lives010AABC1
    Infinite Health0163A9C1

    • Tell A Friend About These Game Cheats:

    Your Email:


    Friend's Email(s):

    Separate multiple emails with commas

    Add A Message: (optional)

    Loading..

    MARIO COMES ALIVE!
    Welcome to MoFunZone, we are THE source for free online games including but not limited to defense games (also tower defense games), arcade, action games, shockwave games, flash games, kid(s) games, game board games, web games, online games, dress up games, internet games and etc. We have the newest and greatest free games and we update every day with new games. Our flash games are played millions of times. MoFunZone is da source for free online games .

    Many people are still into arcade games and we make it easy to find and play these arcade games. Enjoy our classic arcade games.

    Are you a sport jockey? Then we have sports games! And we bring you the newest best sports games on the net, all of them are free games. Check out our sports games category. Whether you want to be play soccer games or racing games, you got it here, even if it is extreme sports like bmx tricks or biking up the sporty hills. Just one category in the free online games we offer at MFZ.

    As for our free games, you will find a lot to choose from right here. You can find action games here for your choosing. MoFunZone.com posts the best in action games and dress up games, all for you to play them for free.

    Family and Kids can play here too, we do our best to keep the site clean and also offer kids games or family-friendly games here at MoFunZone.com. We usually post warnings for non kids games. For kids we have tons of online games for kids, it's one online game to another. Like Spongebob Games

    Yep, we also have board games, the newest and free. Board games, online... that should make it easier!

    For our girl games, we have a lot for you... like hannah montana games, quality gaming fun for all ages! Into super heroes and all that jazz? Why not try our spiderman games for example, you will find lots of action for all ages there!
    Gaming! That's what we're all about! Can you go through all of our games? MoFunZone.com is indeed your first stop for free online games.